Deciphering ROS and ABA mediated WRKY transcription factors under abiotic stress conditions in groundnut

Author: Suchithra B., Shafia Hoor F., Puspha T. C., Nagesh Babu R.

Journal: Журнал стресс-физиологии и биохимии @jspb

Article in issue: 1 т.21, 2025.

Free access

Groundnut (Arachis hypogaea L.,), is an important subsistence oil yielding crop of the semi-arid tropics and often exposed to several environmental cues (high temperature, drought & heavy metal). The WRKY transcription factor (TF) is one of the master regulator, and play vital role in stress responses. However, far less information is available on functional characterization and tolerance mechanism of stress responsive WRKY genes in Groundnut till date. In this study, a comprehensive phylogenetic, protein features, gene structure and motif analysis of WRKY TF gene family was carried out. In addition, we conducted expression profiling of 10 WRKY genes under high temperature, drought and heavy metal (CdCl2). Majority of the AhWRKYs were clustered and share close relationship with Arabidopsis and Glycine max . RT-qPCR analysis of AhWRKY genes revealed that differential expression either in their transcript abundance or in their expression patterns in response to at least one abiotic stress. Of the 10 WRKY genes, AhWRKY41 level was found to be maximum in all the stress conditions . On other hand, AhWRKY20 and AhWRKY22 levels were decreased. The N-terminal of AhWRKY41 showed transcriptional activation in yeast cells. Higher levels of proline content and activities of superoxide dismutase (SOD), catalase (CAT) and peroxidase (POD), but reduced malondialdehyde (MDA), and H2O2 levels were observed in all the stress conditions. The obtained data demonstrate that AhWRKY41 may act as a positive regulator in drought/ high temperature/heavy metal and would exhibit stress tolerance mechanism by activation of stress-associated gene expression by ABA mediated cellular antioxidant systems.

Wrky, abiotic stress, rt- qpcr. transactivation, ros

Short address: https://sciup.org/143183778

IDR: 143183778

Text of the scientific article Deciphering ROS and ABA mediated WRKY transcription factors under abiotic stress conditions in groundnut

Groundnut ( Arachis hypogaea L .,) is an oil yielding crop cultivated worldwide and one of the major grain legumes in tropical and subtropical regions, often exposed to maximum temperature of >40 °C for a short periods during growing season and low or erratic rainfall results in reducing its yield by 40%. However, its productivity is majorly affected by high temperature, drought, and heavy metal, associated with increased population, inherit food demand and global climate change. WRKY superfamily of transcription factors (TFs) are composed of several proteins involved in transcriptional regulation of developmental processes and stress responses. The WRKY TFs characterized by unique WRKYGQK motif followed by a zinc-finger-like motif C 2 H 2 or C 2 HC and evolutionarily highly conserved (Tang et al. , 2014). A single WRKY transcription factor might mediate transcriptional reprogramming associated with several signalling pathways. However, recent advances revealed the enormous significance in eliciting responses induced by abiotic stress conditions. For instance, over-expression of OsWRKY45 and 11 in Arabidopsis results in enhanced tolerance to salt and drought (Qiu, Yu. 2009, Wu et al. , 2009). iu with coauthors and Wang with co-authors ( iu et al. 2012, Wang et al. , 2013) identified 53 TaWRKYs through wheat ESTs and demonstrated, over-expression of TaWRKY2, 10 and 19 exhibiting increased stress tolerance. Recent studies demonstrated WRKY proteins are also involved in regulating developmental processes via auxins, cytokinins, and steroids in the downstream of hormone signaling in the antagonistic functions of salicylic acid (SA) and jasmonic acid (JA)/ethylene (ET) (Bakshi and Oelmüller. 2014). In Arabidopsis expression of TaWRKY79 produced longer primary roots than the wild type in the presence of either aCl or ABA. OsWRKY31 (Rice) and AtWRKY70 (Arabidopsis) were reported to be involved in regulation of disease resistance, root growth, auxin and immune responses, senescence, defense signaling pathways respectively, suggesting their involvement in synchronization of multiple biological processes (Zhang et al. , 2008, Ulker et al. , 2007). GmWRKY21 over-expressing transgenic Arabidopsis were more tolerant to cold, and induced

GmWRKY54 displayed more salt and drought than those of wild type, whereas over-expression of GmWRKY13 results in increased sensitivity to salt and mannitol stress (Zhou et al. , 2008). More recently, overexpression of GsWRKY20, a member of WRKY subgroup III, in alfalfa enhanced to both drought and salt tolerance of the transgenic plants (Tang et al. , 2014). In Populus simonii, 20 WRKY genes showed differential response to various biotic and abiotic stress conditions suggesting they could play vital role in imparting stress tolerance (Zhao et al. , 2010). Extensive research on WRKY TFs has been carried out in the recent past in several crop plants such as rice (Ross et al. , 2007), cucumber (Ling et al. 2011) maize (Wei et al. , 2012), tomato (Huang et al. 2012) etc., due to their important role in various biological, physiological and molecular processes. However, expression and characterization analysis of essential members of these TFs under different abiotic stress in Groundnut is yet to be investigated. In the present study, we have analyzed 10 WRKY encoding transcripts for gene structure, evolutionary relationship, conserved motifs and expression analysis under high temperature, drought and heavy metal stress in Groundnut. For the first time we demonstrated the transcriptional activation of AhWRKY41 that would confer drought/ high temperature/ heavy metal tolerance by activation of cellular antioxidant systems or stress associated genes in Groundnut.

MATERIALS AND METHODS

Identification, characterization and sub- cellular localization of WRKY genes

We retrieved WRKY genes from Plant Transcription Factor Database which shared homology with stress responsive WRKY genes from Arabidopsis and Glycine max. The length, molecular weight and pI of each deduced polypeptide were calculated using the ExpasyProtParam tool . The putative WRKY homologs were determined by BLASTP . Further, CELLO and WOLF PSORT

programs were used to predict the sub- cellular localizations. Multiple sequence alignment of candidate domains from Peanut, Arabidopsis and Glycine max was performed using BioEdit. To study the homology among the 10 WRKY genes, phylogenetic tree was constructed using eighbour joining method.

Conserved motifs and Gene structure analysis

The MEME Suite tool v4.9.1 (Bailey et al., 2009) was used for analysis of the conserved motifs of AhWRKY protein sequences. Gene Structure Display Server from Center for Bioinformatics, Peking University, was used to display the intron exon junctions . The genomic and mR A sequences of WRKY genes were downloaded and used as query for generating its gene structure. The number of introns and exons were estimated based on this alignment and confirmed by the coordinates given in the sequences.

Plant material and abiotic stress treatments

Seeds of Peanut (ICGV1999) were surface-sterilized and grown under controlled conditions at 28 °C day/25 °C night with a 12-h light/12-h dark photo period. After 10 days of germination, seedlings (Shoot, Leaf, Cotyledon, Stem and Root) were exposed to high-temperature (42 °C for 2h (induction) followed by 48 °C for 6h). Drought stress was stimulated by withholding water for 5 days and for heavy metal stress, seedlings were hydroponically exposed to 300µM CdCl 2 for 72h. After the stress treatment, control and stress exposed tissues were harvested immediately and stored at -80 °C for further analysis.

Gene Expression Analysis by qPCR and Pearson correlation

Total R A was isolated from control and stress treated tissues (Shoot, leaf, cotyledon, stem and root) using TRiZol (Invitrogen) according to the manufacturer’s instructions and then treated with R Aase-free D Aase I (Promega). All R A samples were quantified by anodrop 2000 (Thermo Scientific). cD A was synthesized by reverse transcription with 500ng of total R A using PrimeScript RT Reagent Kit (Takara) according to the manufacturer’s instructions. Gene specific primers were designed using Primer3

software (Supplementary file 1). qRT- PCR reactions were performed using SYBR Green PCR Master mix (Takara) on Lightcycler96 Real time PCR (Roche). Each PCR reaction (20 μl) included 2 μl cD A, 1x SYBR Green Master mix, 0.5 μl sequence specific forward primer (10 μM), 0.5 μl reverse primer (10 μM), and 7 μl sterile water. Actin was used as a reference for quantitative the expression of AhWRKY genes. The reactions conditions were 95 °C for 10 min followed by 40 cycles of 95 °C for 15 s, 55 °C for 30s and 72 °C for 15s. Three biological replicates were used. The ΔΔCt method was used for quantification. To analyse the qPCR results of stress inducible AhWRKY genes for statistical significance, Pearson correlation coefficient was used to calculate R and p values at the 0.05 level of significance. STRI G 10 , computational tool was used to predict the proteinprotein interaction of the stress inducible AhWRKY proteins in Arabidopsis with the default parameters.

Transcription Activation of AhWRKY41

For the transactivation assay, complete sequence of AhWRKY41-N open reading frame (ORF) sequence were generated by PCR with primers (Supplementary file 1). The PCR products was fused with yeast GAL4 D A binding domain in frame with the in the vector pGBTK7 (Clontech) between the coI and BamHI sites and the recombinant plasmid was transformed into yeast (AH109), harboring the HIS3 and LacZ reporter genes. Further, yeast strain was plated on SD/Trp- medium and cultured at 30°C. HIS3 activity was assessed for viability test on a histidine-lacking medium with 10 mM 3-AT (3-amino- 1,2,-triazole, Sigma, USA). LacZ activity was tested by β-galactosidase according to the manufacturer’s instructions (Clontech).

Electrolyte leakage, MDA, Proline and Antioxidant enzyme activity assays

Electrolyte leakage was determined using relative conductivity as previously described (Cao et al. , 2007). Lipid peroxidation was estimated as the MDA content (Cui, Wang, 2006), and the free proline content (Shan et al. , 2007). The antioxidant enzyme activities of SOD, POD, CAT in the shoots were estimated as described (Qiu et al. , 2011). Each assay was replicated at least three times per sample.

RESULTS

Characterization of AhWRKY genes and Sub-cellular Localization

We obtained 10 AhWRKY genes and their corresponding protein sequences from Plant Transcription Factor database. Basic information like molecular weight and pI are depicted in Supplementary file 2. The average polypeptide length was 340.8 residues with the length ranging from 199 aa (AhWRKY44) to 568 aa (AhWRKY3). The pI values range from5.2559 to 10.2566. The metal chelation zinc finger motif pattern of the three groups were C-X 4-5 -C-X 22-23 HxH (C2H2) (I), C-X 5 CX 22-23 -HxH (C2H2) (II) and C-X 7 -CX 23 -HXC (C2HC) (III). The sub-cellular localization of 10 AhWRKY proteins were analyzed using             WOLF             PSORT

and CELLO (Yu et al., 2006) programs. The results showed 9/10 AhWRKY proteins were localized to nucleus and 3/10 was predicted to be localized in cytoplasm and chloroplast.

Multiple sequence alignment and phylogenetic analysis

To analyze the features of AhWRKY domain in Groundnut, we performed multiple sequence alignment of the conserved domains derived from Arabidopsis and Glycine max . The alignment reveals, all the 10 AhWRKY proteins share the conserved domain (WRKYGQK) and zinc finger motifs (Figure. 1). To examine their evolutionary relationship we constructed phylogenetic tree and showed well- organized classification of 10 AhWRKYs falls into group I (AhWRKY20, AhWRKY3 and AhWRKY2), group IIa (AhWRKY40), group IIc (AhWRKY12), group IId (AhWRKY15), group IIe (AhWRKY22, AhWRKY44 and AhWRKY69) and group III (AhWRKY41) (Figure. 2).

Analysis of motif composition, Gene structure and Phylogenetic tree

The WRKY share significant sequence conservation within domain regions and to investigate the homologous sequence and frequency of the most prevalent amino acids, sequence logos were produced using the amino acid sequences of AhWRKY proteins in

Expression patterns of AhWRKY genes under different abiotic stress treatments

In order to characterize the relative expression of WRKY genes under different abiotic stress, we conducted qPCR. Under high temperature stress, AhWRKY2, 40, 41, 69 and 44 were found to be up-regulated by 2.9, 1.3, 4.7, 5.2 and 1.02 folds respectively. On the other hand, AhWRKY20, 22, 12, 15 and 3 were down regulated by 0.26, 0.36, 0.91, 0.73 and 0.59 fold respectively (Figure. 5a). During drought, AhWRKY41 and 2 showed 2.4 and 2 fold up regulation while, AhWRKY40 shows significant down regulation by 0.48 fold (Figure. 5b).Under heavy metal stress, most of the genes were down regulated while AhWRKY3 is significantly up regulated by 6.85 fold. To summarize the overall expression patterns, AhWRKY41 showed induced expression in all three stress conditions (Figure. 5c). AhWRKY2 and 69 showed enhanced expression under high temperature and drought while AhWRKY15 shows up-regulation during drought and heavy metal stress. AhWRKY20 gene was repressed in all the three stress conditions. The other genes show differential expression patterns under different abiotic stress which may indicate the involvement of these genes in complex stress regulatory mechanisms. The tissue specific expression (leaf, cotyledon, stem and root) data of 10 AhWRKY genes under abiotic stress were depicted in the Supplementary file 3a. Analysis of Pearson correlation co- efficient of qPCR results with R value of 0.997 and p-value of 0.00001, indicating that the results are significant at <0.05. The prediction of protein- protein interaction between stress inducible AhWRKY orthologs in Arabidopsis was studied by STRI G 10 program. The interaction network shows that out of 10 AhWRKY stress inducible proteins, AhWRKY40, AhWRKY15, AhWRKY22 and AhWRKY44 shows their association with WRKY18, GU 5, WRKY33, STZ, RHL41, DIC2, CZF1 and CML38 (Supplementary file 3b).

yeast cells transformed with pGBKT7- AhWRKY41-grew well in His- medium. Meanwhile, yeast cells transformed with other plasmids could only survive on SD/-Trp medium. The result of LacZ staining showed that the yeast cells transformed with pGBKT7-AhWRKY41- turned blue in the presence of X-gal. These results indicated that the -terminal region of

Transcription Activation of AhWRKY41 and

AhWRKY41 has transcription activation activity. More antioxidant enzymes

than 2 fold expression of Ah WRKY41 suggests abiotic

To verify AhWRKY41 transcriptional activation of full length AhWRKY41 ORF, Yeast strain AH109 was transformed with fusion plasmids pGBKT7-AhWRKY41-, and pGBKT7 as a control. As shown in Figure. 6, the stress tolerance in Groundnut and exhibited a higher levels proline and superoxide dismutase (SOD) content, as well as higher activities of catalase (CAT) and peroxidase (POD), but less ion leakage (IL), lower contents of malondialdehyde (MDA) and H2O2.

Group I NT    11    JI

1 J

AhWRKY20 GmWRKY20 ACWRKY20 AHWRKY3:

GmWRKY3:

ACWRKY3:

AhWRRY2: GmWRKY2:

ACWRKY2:

SDDGYNWRKYGGKLVKGSEFPRSYYKCTHPNCEVKKLFERSHEGQITEIIYKGTHEH: sdegynwrkygqkhvkgsefprsyykcthpncbvkklfershegqiteiiykgtheh: ADEGYNWRKYGQKHVKGSEFPRSYYKCTHPNcjvKKLFERSBEGqiTEIIYKGTHEH: ADEGYNWRKYGGKQVKGSEFPRSYYKCTHLNCPVKKKVERAPEGHITEIIYKGQHNHl ADEGYNWRKYGCKQVKGSEYPRSYYKCTHLNCVVKKKVERAEEGHITEIIYKGQHNH ADEGYNWRKYGCKqVKGSDFPRSYYKCTHPACFVKKKVERSLEGCVTEIIYKGqHNH] seegynwrkyggkgvkgseyprsyykcthpncevkmkversheghiteiiykgahnh: SEEGYNWRKYGGKQVKGSEYPRSYYKCTHPNCGVKKKVERSHEGHITEIIYKGTHEU AEEGYNWRKYGGKLVKGSEYPRSYYKCTNPNCgVKKKVERSREGHITEIIYKGAHNK

CT

AhWRKY20В

GmWRKY20I

ACWRKY20I

AhWRKY3:I

GmWRKY3:I

ARWRKY3:|

AhWRKY2:|

GmWRKY2 : !

AtWRKY2: L

SRKYGQKVVRGNPNPRSYYKCTNAGCeVRKHVERASHEPKAVITTYEGKHN: «RKYGGKVVRGNPNPRSYYKCTNTGCPVRKHVERASHEPKAVITTYEGKHN' «rkygqkvvrgnpnprsyykctahgcpvrkhverashdpkavittyegkhd. rJRKYGGKVVKGNPHPRSYYKCTSAGCNVRKHVERASSEPKAVITTYEGKHN rJRKYGQKVVKGNPHPRSYYKCTSAGC&VRKHVERASTEPKAVITTYEGKHN rtRKYGGKVVKGNPYPRSYYKC~TPCCGVRKHVERAATEPKAVVTTYEGKHN «RKYGCKVVKGNPNPRSYYKCT^AGC^VRKHVERESHDLKSVITTYEGKHN: SRKYGGKVVKGNPNPRSYYKCTtaGCaVRKHVERASHELKSVITTYEGKHN: flRKYGGKVVKGNPNPRSYYKcAPGcSvRKHVERASHELKSVITTYEGKHN:

Group П         j j

AhWRKY40:

AtWRKY40:

GmWRKY40:

VKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVCRSVEDQSVLVATYEGEHNHP-L VKDGYQWRKYGQKVTRDNPSPRAYFKCACAPSCSVKKKVQRSVEDGSVLVATYEGEHNHP-M VKEGYGWRKYGCKVTRDNPCPRAYFKCSFAPSCPVKKKVGRgVEEGSVLVATYEGEHNHPgg

AhWRKY15:

AtWRKY15:

GmWRKY15:

PPDDYSWRKYGGKPIKGSFHPRGYYKCSSVRGCPARKHVERA1EESSMLVVTYEGEHNHSLTAA PPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAAEESSMLIVTYEGBHNHSLSAA PPEEYSHRKYGGKPIKGSPHPRGYYKCSSVRGCPARKHVERAIEEPSMLVVTYEGEHNHTLSAA

AhWRKY12:

AtWRKY12:

GmWRKY12:

tCEGYKKRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSECCRMVITTYEGRHNHSPCEDSl LEEGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEECRMVITTYEGRHNHIPSEES1 |LEEGYKWRKYGGKVVKNSLHPRSYYRCTHNNCRVKKRVERL3EECRMVITTYEGRHNH3PCDDS1

AHWRKY22: AtWRKY22: GmWRKY22: AhWRKY69: AtWRKY69: GmWRKY52: AhWRKY44:

PIKGSPYPRGYYRCSSSKGCLARKqVERNRTCPTMFIVTYMEHNHPAPTHl pikg3pyprgyybcstskgclarkqvernr3e₽kmfivt;taehnhpa:-th]

SSZIWAWRKYGCKPIKGSPYPRGYYRCSSSKGCLAREqVERNRSDPTMFIvi:T*EHNHPi TH: PSESWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPARKQVERSRVEPTKLIVTYireEHNHSlPVTl PSESWAHRKYGQKPIKGSPYPRGYYRCSSSKGCPARKQVERSRVEPSKLMITYACDHNHPIPSS: PSLSWAWRKYGQKFIKGSPYFRGYYRCSSSKGCPARKCVERSRVrFTXlT'TYAYEHNHSlPlPl

ISYDGYNWRKYGGKCVKGSEYFRSYYKCTHPN

KKK7EP3-FEGGIAEIVYKGEHSHPKPQPI

GroupIII     11       11            11

AHWRKY41:

ACWRKY41:

GmWRKY53:

HEESYNWRKYGCKEILGAKYPRSYYRCTFRNTQGCWATKCVCRSDEDPTIFDITYKGeHTCSQG HEDlFSWRKYGGKDILGAKFPRSYYRCTFRNTQYCWATKGVQRSEGDPTIFEVTYRGfHTCSQG HEE3YNWRKYGGKEILGAKYPR3YYRCTFRNTGGCWATKGVGR3CEEPTVFDITYRGBHTCSGG

Figure 1: Multiple sequence alignment of conserved WRKY domains from Peanut, Arabidopsis and Glycine max . T and CT represent termini and C termini of Group I WRKY domains respectively. The highly conserved WRKYGQK domain is indicated between the arrows. Cystein (C) and Histidine (H) are represented by arrows which indicate the zinc finger motifs.

Figure 2. Un-rooted Phylogenetic tree of Peanut, Arabidopsis and Glycine max WRKY sequences. The tree was constructed by the MEGA v6.0 program with the eighbor-Joining algorithm. The evolutionary relations were calculated using the p-distance method.

Figure 3: a) The domain prediction of ten A. hypogaea WRKY protein sequences was performed using MEME software, which generated a letter logo to represent the WRKY domain, zinc finger and other motifs. The height of the letters in the y-axis represents the degree of conservation and relative frequency of each amino acid at that position. b) The distribution of conserved motifs among the putative AhWRKY proteins is shown and different motifs are represented by different color blocks as indicated at the bottom of the figure.

<лч>

ЗОЙЬр          1М0ф         1ЯЮЬр         ’WOt®         230№р         iOOQbji         JJMbf         «сад»         *?Mbp

Enon — Intron

Figure 4: Phylogenetic relationship and gene structure of the WRKY genes. Yellow box indicate exons and black line indicates introns.

Figure 5: Expression pattern of 10 AhWRKY transcription factors. a) High temperature b) Drought c) Heavy metal

Figure 6: Transactivation assay of AhWRKY41 in yeast. The plasmids contains the fusion genes and the control plasmid (pGBTK7) (White) were expressed in yeast strain AH109. The transformants (Blue) were streaked on plates containing SD/Trp- and X- gal.

Figure 7: Changes in a) H 2 O 2 (µmoles/ g FW) b) MDA (nmoles/ g FW) and c) Proline content (µmoles/ gFW). Values are mean of three replicates ±SE.

Figure 8: Changes in activities of a) SOD (IU/ g FW) b) POD (IU/ gFW) and c) CAT (IU/ gFW). Values are mean of three

replicates ±SE.

DISCUSSION

Plants have developed a great ability to reprogram their transcriptome in a highly dynamic and temporal approach through an integrated network of transcription factors to adapt to the changing environmental stress conditions. Among these, WRKY proteins are important members of transcription factors involved in regulation of plant stress responses (Pandey, Somssich, 2009). Although it has been well documented that WRKY TFs were connected with various plant defense mechanisms under abiotic stress conditions. Meanwhile, non-WRKY genes that enhance plant drought and salt stress by either efficient ROS elimination through the activation of the cellular antioxidant systems or the activation of stress-associated genes have been extensively reported in Arabidopsis (Moon et al. 2003, Luo et al. 2009), Oryza sativa ( ing et al., 2010, Kumar et al. 2012), Poncirus trifoliate (Huang et al., 2010, Huang et al., 2011), and wheat (Hu et al., 2012, Hu et al., 2013). Functional characterization and deciphering the stress tolerance mechanism by WRKY was elucidated only in model crops. In groundnut, no reports on expression and functional characterization of stress associated WRKYs is found till date. Multiple sequence alignment of the Peanut WRKY domain shows homology with Arabidopsis and Glycine max. Hence, we predict that the functional annotations of AhWRKYs may be fairly similar to AtWRKYs and GmWRKYs. Phylogenetic analysis reveals that 10 WRKYs were classified into three groups. Of the three, the Group II were found to be abundant, which includes AhWRKY22, AhWRKY40, AhWRKY12, AhWRKY15, AhWRKY69 and AhWRKY44, were further assembled into four sub-groups (IIa, IIc, IId and IIe). The WRKY protein belonging to Group I identified in every ancestral organism has two WRKY domains and represents the ancestral form and evolved early (Wei et al., 2012). In addition, motifs analysis using MEME tool confirms the presence of WRKY domain and zinc finger motifs. Previously, it was reported that, among the two domains only the C- terminal domain belonging to Group I has sequence specific D A binding activity with W- box while -terminal domain showed weaker binding activity (Llorca et al., 2014). However, the -terminal WRKY domain might alternatively provide an interface for protein- protein interactions that coincide with the function of zinc- finger like domains (Wei et al., 2012). It was assumed that, due to the variability in the - terminal domain during evolution, it may be evolved into another pattern to accomplish other regulatory functions or deleted from the sequence. As WRKY genes are themselves transcriptionally regulated, understanding the regulatory processes governed by these genes is a challenge. However, their distinct expression pattern in various tissues under specific biological condition might unfold the regulatory functions of these transcription factors. Several studies have described the essential roles of WRKY TFs in the regulation of gene expression (Raineri et al., 2015). In various plants such as Arabidopsis, rice, Glycine max, wheat, cotton, maize and Populus, a number of WRKY genes are characterized that function as key regulators in signaling pathways for resistance to abiotic stress (Dong et al., 2003, Wei et al., 2012, Zhao et al., 2015). In present study, we imposed three abiotic stress treatments such as high temperature, drought and heavy metal on 10 day old seedlings and studied expression analysis of AhWRKY genes. The results indicated that most of the AhWRKY genes were induced in various tissues. Compared to the drought and heavy metal stress, there are few reports on response of WRKY genes to high temperature stress. AhWRKY41 is induced in all the three stresses in various tissues including leaf, cotyledon, stem and root indicating that it may be involved in multi abiotic stress response. Ding et al. (2014) reported the regulation of ABI3 expression and seed dormancy by WRKY41 and ABA in Arabidopsis. Luo et al. (2013) demonstrated the tolerance of GsWRKY20 over-expression lines to drought which exhibited decreased water loss rate and stomatal density in Arabidopsis and also showed the transgenic lines mediated ABA signaling by selectively promoting the expression of negative regulators and repressing the positive regulators. Our study emphasize,AhWRKY20 shares homology with GmWRKY20 is repressed in all three abiotic stress conditions and AhWRKY40 is repressed in drought and heavy metal stress suggests these genes might play an important role in drought stress response and ABA signaling. Zhou et al. (2011) analysed the physiological function of the Arabidopsis WRKY22 during dark-induced senescence which was suppressed by light and promoted by darkness, thus evidences the participation of AtWRKY22 in the dark-induced senescence. Our results showed that AhWRKY22 repressed in all three stress conditions which gives a clue that it could be involved in senescence. Further, AhWRKY2 was induced in response to high temperature and drought stress and evidences shows its homology in Arabidopsis, WRKY2 transcription factor mediates seed germination and post germination developmental arrest by ABA (Jiang and Yu, 2009). Lai et al. (2008) demonstrated the positive role of WRKY3 and WRKY4 in plant resistance to necrotrophic pathogens. Interestingly, AhWRKY3 is highly induced under cadmium and drought stress which gives evidence for its role in stress responses in Peanut. WRKYs TFs were implicated integrating ROS homeostasis regulation and abiotic stress resistance in many crops. A recent study explored APTEALA 2 is regulated by different members of WRKY and AC family, in addition, the link between the ROS-response ZAT12 zinc finger protein and iron regulation in cells (Wang et al. 2013, Wang et al. 2016). Le et al. (2016) reported that ZAT12 interacts with and suppresses the function of a central regulator of iron deficiency responses, the basic helix-loop-helix transcription factor FER-LIKE IRO DEFICIE CY-I DUCED TRA SCRIPTIO FACTOR. The iron uptake is suppressed and risk of hydroxyl radical formation is prevented by up- regulation of ZAT12 in response to ROS accumulation (Dietz et al. 2016). Similarly W-box promoter of RBOH, and WRKY is phosphorylated by MAPK, linking MAPK phosphorylation events in response to pathogen recognition with accumulation in tobacco. Recently ROS-response regulatory proteins were explored by underlying the APETALA2/ethylene response transcription factor redox responsive transcription factor 1 regulated WRKYs (Matsuo et al. 2015). GhWRKY involved in stress response by regulating ABA signalling and cellular levels of ROS. Sun et al., (Sun et al., 2015) isolated WRKY gene BdWRKY 36 from B. distachyon and found its functions as a positive regulator of drought by controlling ROS homeostasis and regulating stress related genes. The protein- protein interaction network identified WRKY18, GU 5, WRKY33, STZ, RHL41, DIC2, CZF1 and CML38 which show association with AhWRKY proteins. WRKY18 and WRKY33 interacting with elicitor-responsive cis-acting element, positively modulates defense-related gene expression and disease resistance

(Chen et al. 2010, Birkenbihl et al. 2012). GU 5 (GE OMES U COUPLED 5), a multifunctional protein was involved in chlorophyll synthesis, plastid-to-nucleus retrograde signalling and ABA perception (Mochizuki et al. , 2001). STZ (salt tolerance zinc finger), was found to repress the stress responsive genes DREB1A and LTI78 and could be involved in jasmonate (JA) early signalling response. Similarly, RHL41 is involved in light acclimation, cold and oxidative stress responses (Iida et ak., 2000), while DIC2 could be involved in protecting plant cells against oxidative stress. CZF1 (zinc finger CCCH domain-containing protein) is involved in salt stress response.

CONCLUSION

AhWRKY41, a group of III WRKY family member was annotated from Groundnut for the first time, which was significantly up- regulated by abiotic stress conditions and exhibits transcriptional activation in yeast cells. Further, accumulation of proline and H 2 O 2 , decreased MDA and improved ROS system emphasise AhWRKY41 may serve as a positive regulator and synergistic regulation by ROS homeostasis through direct or indirect activation of the cellular antioxidant systems or activation of stress-associated gene expression.

CONFLICTS OF INTEREST

The author declare that he has no potential conflicts of interest.

References Deciphering ROS and ABA mediated WRKY transcription factors under abiotic stress conditions in groundnut

  • Asako Iida, Kazuoka, T., Torikai, S., Kikuchi, H., & Oeda, K. (2000). A zinc finger protein RHL41 mediates the light acclimatization response in Arabidopsis. The Plant Journal, 24(2), 191-203.
  • Bailey, T. L., Boden, M., Buske, F. A., Frith, M., Grant, C. E., Clementi, L.,... & Noble, W. S. (2009). MEME SUITE: tools for motif discovery and searching. Nucleic acids research, 37(suppl_2), W202-W208.
  • Bakshi, M., & Oelmüller, R. (2014). WRKY transcription factors: Jack of many trades in plants. Plant signaling & behavior, 9(2), e27700.
  • Birkenbihl, R. P., Diezel, C., & Somssich, I. E. (2012). Arabidopsis WRKY33 is a key transcriptional regulator of hormonal and metabolic responses toward Botrytis cinerea infection. Plant physiology, 159(1), 266-285.
  • Cao, W. H., Liu, J., He, X. J., Mu, R. L., Zhou, H. L., Chen, S. Y., & Zhang, J. S. (2007). Modulation of ethylene responses affects plant salt-stress responses. Plant physiology, 143(2), 707-719.
  • Chen, H., Lai, Z., Shi, J., Xiao, Y., Chen, Z., & Xu, X. (2010). Roles of Arabidopsis WRKY18, WRKY40 and WRKY60 transcription factors in plant responses to abscisic acid and abiotic stress. BMC plant biology, 10, 1-15.
  • Cui, Y., & Wang, Q. (2006). Physiological responses of maize to elemental sulphur and cadmium stress. Plant Soil and Environment, 52(11), 523.
  • Dietz, K. J., Mittler, R., & Noctor, G. (2016). Recent progress in understanding the role of reactive oxygen species in plant cell signaling. Plant physiology, 171(3), 1535-1539.
  • Ding, Z. J., Yan, J. Y., Li, G. X., Wu, Z. C., Zhang, S. Q., & Zheng, S. J. (2014). WRKY 41 controls Arabidopsis seed dormancy via direct regulation of ABI 3 transcript levels not downstream of ABA. The Plant Journal, 79(5), 810-823.
  • Dong, J., Chen, C., & Chen, Z. (2003). Expression profiles of the Arabidopsis WRKY gene superfamily during plant defense response. Plant molecular biology, 51, 21-37.
  • Hu, W. E. I., Huang, C., Deng, X., Zhou, S., Chen, L., Li, Y. I. N.,... & He, G. (2013). TaASR1, a transcription factor gene in wheat, confers drought stress tolerance in transgenic tobacco. Plant, cell & environment, 36(8), 1449-1464.
  • Hu, W., Yuan, Q., Wang, Y., Cai, R., Deng, X., Wang, J.,... & He, G. (2012). Overexpression of a wheat aquaporin gene, TaAQP8, enhances salt stress tolerance in transgenic tobacco. Plant and Cell Physiology, 53(12), 2127-2141.
  • Huang, S., Gao, Y., Liu, J., Peng, X., Niu, X., Fei, Z.,... & Liu, Y. (2012). Genome-wide analysis of WRKY transcription factors in Solanum lycopersicum. Molecular Genetics and Genomics, 287, 495-513.
  • Huang, X. S., Liu, J. H., & Chen, X. J. (2010). Overexpression of PtrABF gene, a bZIP transcription factor isolated from Poncirus trifoliata, enhances dehydration and drought tolerance in tobacco via scavenging ROS and modulating expression of stress-responsive genes. BMC plant biology, 10, 1-18.
  • Huang, X. S., Luo, T., Fu, X. Z., Fan, Q. J., & Liu, J. H. (2011). Cloning and molecular characterization of a mitogen-activated protein kinase gene from Poncirus trifoliata whose ectopic expression confers dehydration/drought tolerance in transgenic tobacco. Journal of experimental botany, 62(14), 5191-5206.
  • Jiang, W., & Yu, D. (2009). Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid. BMC plant biology, 9, 1-14.
  • Kumar, G., Kushwaha, H. R., Panjabi-Sabharwal, V., Kumari, S., Joshi, R., Karan, R.,... & Pareek, A. (2012). Clustered metallothionein genes are coregulated in rice and ectopic expression of OsMT1e-P confers multiple abiotic stress tolerance in tobacco via ROS scavenging. BMC Plant Biology, 12, 1-16.
  • Lai, Z., Vinod, K. M., Zheng, Z., Fan, B., & Chen, Z. (2008). Roles of Arabidopsis WRKY3 and WRKY4 transcription factors in plant responses to pathogens. BMC plant biology, 8, 1-13.
  • Le, C. T. T., Brumbarova, T., Ivanov, R., Stoof, C., Weber, E., Mohrbacher, J.,... & Bauer, P. (2016). Zinc finger of Arabidopsis thaliana12 (ZAT12) interacts with FER-like iron deficiency-induced transcription factor (FIT) linking iron deficiency and oxidative stress responses. Plant Physiology, 170(1), 540-557.
  • Ling, J., Jiang, W., Zhang, Y., Yu, H., Mao, Z., Gu, X.,... & Xie, B. (2011). Genome-wide analysis of WRKY gene family in Cucumis sativus. BMC genomics, 12, 1-20.
  • Llorca, C. M., Potschin, M., & Zentgraf, U. (2014). bZIPs and WRKYs: two large transcription factor families executing two different functional strategies. Frontiers in plant science, 5, 169.
  • Luo, X., Bai, X., Sun, X., Zhu, D., Liu, B., Ji, W.,... & Zhu, Y. (2013). Expression of wild soybean WRKY20 in Arabidopsis enhances drought tolerance and regulates ABA signalling. Journal of experimental botany, 64(8), 2155-2169.
  • Luo, Y., Liu, Y. B., Dong, Y. X., Gao, X. Q., & Zhang, X. S. (2009). Expression of a putative alfalfa helicase increases tolerance to abiotic stress in Arabidopsis by enhancing the capacities for ROS scavenging and osmotic adjustment. Journal of Plant Physiology, 166(4), 385-394.
  • Matsuo, M., Johnson, J. M., Hieno, A., Tokizawa, M., Nomoto, M., Tada, Y.,... & Oelmüller, R. (2015). High REDOX RESPONSIVE TRANSCRIPTION FACTOR1 levels result in accumulation of reactive oxygen species in Arabidopsis thaliana shoots and roots. Molecular Plant, 8(8), 1253-1273.
  • Mochizuki, N., Brusslan, J. A., Larkin, R., Nagatani, A., & Chory, J. (2001). Arabidopsis genomes uncoupled 5 (GUN5) mutant reveals the involvement of Mg-chelatase H subunit in plastidto-nucleus signal transduction. Proceedings of the National Academy of sciences, 98(4), 2053-2058.
  • Moon, H., Lee, B., Choi, G., Shin, D., Prasad, D. T., Lee, O.,... & Yun, D. J. (2003). NDP kinase 2 interacts with two oxidative stress-activated MAPKs to regulate cellular redox state and enhances multiple stress tolerance in transgenic plants. Proceedings of the National Academy of Sciences, 100(1), 358-363.
  • Ning, J., Li, X., Hicks, L. M., & Xiong, L. (2010). A Raflike MAPKKK gene DSM1 mediates drought resistance through reactive oxygen species scavenging in rice. Plant physiology, 152(2), 876-890.
  • Niu, C. F., Wei, W. E. I., Zhou, Q. Y., Tian, A. G., Hao, Y. J., Zhang, W. K.,... & Chen, S. Y. (2012). Wheat WRKY genes TaWRKY2 and TaWRKY19 regulate abiotic stress tolerance in transgenic Arabidopsis plants. Plant, cell & environment, 35(6), 1156-1170.
  • Pandey, S. P., & Somssich, I. E. (2009). The role of WRKY transcription factors in plant immunity. Plant physiology, 150(4), 1648-1655.
  • Qiu, Y., & Yu, D. (2009). Over-expression of the stressinduced OsWRKY45 enhances disease resistance and drought tolerance in Arabidopsis. Environmental and experimental botany, 65(1), 35-47.
  • Qiu, Z. B., Li, Q., Bi, Z. Z., & Yue, M. (2011). Hydrogen peroxide acts as a signal molecule in CO2 laser pretreatment-induced osmotic tolerance in wheat seedlings. Plant, Soil and Environment, 57(9), 403-408.
  • Raineri, J., Wang, S., Peleg, Z., Blumwald, E., & Chan, R. L. (2015). The rice transcription factor OsWRKY47 is a positive regulator of the response to water deficit stress. Plant molecular biology, 88, 401-413.
  • Ross, C. A., Liu, Y., & Shen, Q. J. (2007). The WRKY gene family in rice (Oryza sativa). Journal of Integrative Plant Biology, 49(6), 827-842.
  • Shan, D. P., Huang, J. G., Yang, Y. T., Guo, Y. H., Wu, C. A., Yang, G. D.,... & Zheng, C. C. (2007). Cotton GhDREB1 increases plant tolerance to low temperature and is negatively regulated by gibberellic acid. New Phytologist, 176(1), 70-81.
  • Sun, J., Hu, W., Zhou, R., Wang, L., Wang, X., Wang, Q.,... & Yang, G. (2015). The Brachypodium distachyon BdWRKY36 gene confers tolerance to drought stress in transgenic tobacco plants. Plant cell reports, 34, 23-35.
  • Tang, J., Wang, F., Hou, X. L., Wang, Z., & Huang, Z. N. (2014). Genome-wide fractionation and identification of WRKY transcription factors in Chinese cabbage (Brassica rapa ssp. pekinensis) reveals collinearity and their expression patterns under abiotic and biotic stresses. Plant Molecular Biology Reporter, 32, 781-795.
  • Ülker, B., Shahid Mukhtar, M., & Somssich, I. E. (2007). The WRKY70 transcription factor of Arabidopsis influences both the plant senescence and defense signaling pathways. Planta, 226, 125-137.
  • Wang, C., Deng, P., Chen, L., Wang, X., Ma, H., Hu, W.,... & He, G. (2013). A wheat WRKY transcription factor TaWRKY10 confers tolerance to multiple abiotic stresses in transgenic tobacco. PloS one, 8(6), e65120.
  • Wang, Z., Li, P., Yang, Y., Chi, Y., Fan, B., & Chen, Z. (2016). Expression and functional analysis of a novel group of legume-specific WRKY and Exo70 protein variants from soybean. Scientific Reports, 6(1), 32090.
  • Wei, K. F., Chen, J., Chen, Y. F., Wu, L. J., & Xie, D. X. (2012). Molecular phylogenetic and expression analysis of the complete WRKY transcription factor family in maize. DNA research, 19(2), 153-164.
  • Wu, X., Kishitani, S., Ito, Y., & Toriyama, K. (2009). Accumulation of raffinose in rice seedlings overexpressing OsWRKY11 in relation to desiccation tolerance. Plant biotechnology, 26(4), 431-434.
  • Yu, C. S., Chen, Y. C., Lu, C. H., & Hwang, J. K. (2006). Prediction of protein subcellular localization. Proteins: Structure, Function, and Bioinformatics, 64(3), 643-651.
  • Zhang, J., Peng, Y., & Guo, Z. (2008). Constitutive expression of pathogen-inducible OsWRKY31 enhances disease resistance and affects root growth and auxin response in transgenic rice plants. Cell Research, 18(4), 508-521.
  • Zhao, H., Wang, S., Chen, S., Jiang, J., & Liu, G. (2015). Phylogenetic and stress-responsive expression analysis of 20 WRKY genes in Populus simonii× Populus nigra. Gene, 565(1), 130-139.
  • Zhou, Q. Y., Tian, A. G., Zou, H. F., Xie, Z. M., Lei, G., Huang, J.,... & Chen, S. Y. (2008). Soybean WRKY‐type transcription factor genes, GmWRKY13, GmWRKY21, and GmWRKY54, confer differential tolerance to abiotic stresses in transgenic Arabidopsis plants. Plant biotechnology journal, 6(5), 486-503.
  • Zhou, X., Jiang, Y., & Yu, D. (2011). WRKY22 transcription factor mediates dark-induced leaf senescence in Arabidopsis. Molecules and cells, 31, 303-313.
More